Antibodies

Jump to Filters
View as table Download
NDUFA3 Rabbit Polyclonal Antibody
TA343224

USD 375.00

5 Days

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ndufa3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ndufa3. Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL
NDUFA3 Rabbit Polyclonal Antibody
TA350213

USD 345.00

In Stock

Rabbit Polyclonal Anti-NDUFA3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFA3