Antibodies

View as table Download

Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human AMT

Rabbit Polyclonal Anti-AMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated