Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AMT |
Aminomethyltransferase (AMT) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human AMT |
Rabbit Polyclonal Anti-AMT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
AMT mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
AMT mouse monoclonal antibody, clone OTI5D12 (formerly 5D12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 379.00
In Stock
AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |