Antibodies

View as table Download

Rabbit polyclonal anti-CA5B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA5B.

Rabbit Polyclonal Anti-CA5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA5B antibody: synthetic peptide directed towards the N terminal of human CA5B. Synthetic peptide located within the following region: WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL