Antibodies

View as table Download

Rabbit Polyclonal Anti-COX15 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY

Mouse Monoclonal anti-Cytochrome c Antibody

Applications WB
Reactivities Most Species
Conjugation Unconjugated