Antibodies

Jump to Filters
View as table Download
PGLS Rabbit Polyclonal Antibody
TA344307

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGLS Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
PGLS Rabbit Polyclonal Antibody
TA315287

USD 345.00

In Stock

Rabbit polyclonal anti-PGLS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PGLS.
PGLS (C-term) Rabbit Polyclonal Antibody
AP17634PU-N

USD 450.00

2 Weeks

PGLS (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human PGLS