Antibodies

View as table Download

RPS7 mouse monoclonal antibody, clone 3G4

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-RPS7 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RPS7.

Rabbit Polyclonal Anti-RPS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS7 Antibody: synthetic peptide directed towards the N terminal of human RPS7. Synthetic peptide located within the following region: MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Rabbit Polyclonal Anti-RPS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS7 Antibody: synthetic peptide directed towards the middle region of human RPS7. Synthetic peptide located within the following region: RIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEF