Antibodies

View as table Download

Rabbit Polyclonal Anti-GGPS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ

Rabbit Polyclonal Anti-GGPS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the C terminal of human GGPS1. Synthetic peptide located within the following region: LEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE

GGPS1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 173-202 amino acids from the Central region of human GGPS1

Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

GGPS1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-GGPS1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GGPS1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated