Antibodies

Jump to Filters
View as table Download
RRAS2 Rabbit Polyclonal Antibody
TA308124

USD 415.00

5 Days

Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 204 of TC21 (Uniprot ID#P62070)
RRAS2 Rabbit Polyclonal Antibody
TA319836

USD 430.00

5 Days

Rabbit Polyclonal RRAS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Rabbit polyclonal RRAS2 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human RRAS2.
RRAS2 Rabbit Polyclonal Antibody
TA334999

USD 375.00

5 Days

Rabbit Polyclonal Anti-RRAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RRAS2 antibody is: synthetic peptide directed towards the C-terminal region of Human RRAS2. Synthetic peptide located within the following region: EASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
RRAS2 Rabbit Polyclonal Antibody
TA350377

USD 345.00

In Stock

Rabbit Polyclonal Anti-RRAS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RRAS2