Antibodies

View as table Download

Rabbit polyclonal AGBL5 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AGBL5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 99-127 amino acids from the N-terminal region of human AGBL5.

Goat Anti-AGBL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CFSKPEEAGSHVE, from the internal region of the protein sequence according to NP_001041657.1.

Rabbit Polyclonal Anti-AGBL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AGBL5 Antibody: synthetic peptide directed towards the C terminal of human AGBL5. Synthetic peptide located within the following region: RGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLSRARSFSTGTSAGG

Rabbit Polyclonal Anti-AGBL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AGBL5 Antibody: synthetic peptide directed towards the C terminal of human AGBL5. Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS