Antibodies

Jump to Filters
View as table Download
TNNI3K (FPGT-TNNI3K) Rabbit Polyclonal Antibody
TA346505

USD 475.00

5 Days

Rabbit Polyclonal Anti-TNNI3K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNI3K antibody: synthetic peptide directed towards the N terminal of human TNNI3K. Synthetic peptide located within the following region: LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED
TNNI3K (FPGT-TNNI3K) Rabbit Polyclonal Antibody
TA308400

USD 415.00

5 Days

Rabbit polyclonal antibody to TNNI3K (TNNI3 interacting kinase)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 187 and 403 of TNNI3K (Uniprot ID#Q59H18)