Antibodies

View as table Download

KCNQ1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KCNQ1

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI

Mouse monoclonal KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNQ1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 11-42 amino acids from the N-terminal region of human KCNQ1

Goat Anti-KCNQ1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1.

Rabbit Polyclonal Anti-KV7.1 (KCNQ1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus.

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ1

KCNQ1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNQ1