Antibodies

View as table Download

OR10J5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 250-278 amino acids from the C-terminal region of human OR10J5

Rabbit Polyclonal Anti-OR10J5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR10J5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10J5. Synthetic peptide located within the following region: CIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTF