OR5B12 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 285-314 amino acids from the C-terminal region of human Olfactory receptor 5B12 |
OR5B12 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 285-314 amino acids from the C-terminal region of human Olfactory receptor 5B12 |
Rabbit Polyclonal Anti-OR5B12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR5B12 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5B12. Synthetic peptide located within the following region: EMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCASHL |