Antibodies

Jump to Filters
View as table Download
Seryl tRNA synthetase (SARS) Rabbit Polyclonal Antibody
TA345970

USD 410.00

5 Days

Rabbit Polyclonal Anti-SARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SARS antibody: synthetic peptide directed towards the middle region of human SARS. Synthetic peptide located within the following region: SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL
SARS1 Rabbit Polyclonal Antibody
TA370656

USD 380.00

4 Weeks

SARS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SARS1