Antibodies

Jump to Filters
View as table Download
TNFSF18 Rabbit Polyclonal Antibody
TA306245

USD 430.00

5 Days

Rabbit Polyclonal GITRL Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen GITRL antibody was raised against purified recombinant human GITR ligand.
TNFSF18 (Center) Rabbit Polyclonal Antibody
AP54315PU-N

USD 450.00

2 Weeks

TNFSF18 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human TNFSF18
TNFSF18 Rabbit Polyclonal Antibody
TA338996

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFSF18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF18 antibody: synthetic peptide directed towards the middle region of human TNFSF18. Synthetic peptide located within the following region: KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN