Antibodies

View as table Download

Rabbit Polyclonal Anti-ARL11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARL11 antibody: synthetic peptide directed towards the middle region of human ARL11. Synthetic peptide located within the following region: WKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANK

Carrier-free (BSA/glycerol-free) ARL11 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARL11 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

ARL11 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

ARL11 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ARL11 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

ARL11 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".