Rabbit Polyclonal Anti-BCL11A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the N terminal of human BCL11A. Synthetic peptide located within the following region: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQ |
Rabbit Polyclonal Anti-BCL11A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BCL11A antibody: synthetic peptide directed towards the C terminal of human BCL11A. Synthetic peptide located within the following region: YACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDR |
Rabbit anti-BCL11A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BCL11A |
Germany
Japan
United Kingdom
China
