Antibodies

View as table Download

Rabbit Polyclonal antibody to TCP1 epsilon (chaperonin containing TCP1, subunit 5 (epsilon))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 338 of TCP1 epsilon (Uniprot ID#P48643)

Rabbit Polyclonal antibody to TCP1 epsilon (chaperonin containing TCP1, subunit 5 (epsilon))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 264 of TCP1 epsilon (Uniprot ID#P48643)

Rabbit polyclonal anti-CCT5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCT5.

Rabbit Polyclonal Anti-CCT5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CCT5 antibody: synthetic peptide directed towards the N terminal of human CCT5. Synthetic peptide located within the following region: NDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEAE

Rabbit Polyclonal Anti-CCT5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCT5 antibody: synthetic peptide directed towards the C terminal of human CCT5. Synthetic peptide located within the following region: DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE

CCT5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CCT5 (NP_036205.1).
Modifications Unmodified