Antibodies

View as table Download

Goat Polyclonal Antibody against CRP2 / CSRP2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-ERLGIKPESVQP, from the internal region of the protein sequence according to NP_001312.1.

Rabbit Polyclonal Anti-CSRP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSRP2 antibody: synthetic peptide directed towards the C terminal of human CSRP2. Synthetic peptide located within the following region: FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

CSRP2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CSRP2

CSRP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSRP2

CSRP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human CSRP2 (NP_001312.1).
Modifications Unmodified