Antibodies

View as table Download

Rabbit Polyclonal Anti-CTPS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTPS antibody: synthetic peptide directed towards the N terminal of human CTPS. Synthetic peptide located within the following region: SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR

Rabbit Polyclonal Anti-CTPS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTPS antibody: synthetic peptide directed towards the C terminal of human CTPS. Synthetic peptide located within the following region: FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH

CTPS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 402-591 of human CTPS1 (NP_001896.2).
Modifications Unmodified