Antibodies

View as table Download

Rabbit Polyclonal Anti-C14orf159 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-C14orf159 antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf159. Synthetic peptide located within the following region: AKKIPGISSTGVGDGGNELGMGKVKEAVRRHIRHGDVIACDVEADFAVIA

DGLUCY rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human DGLUCY