Antibodies

View as table Download

Rabbit polyclonal antibody to DNAI2 (dynein, axonemal, intermediate chain 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 382 and 605 of DNAI2 (Uniprot ID#Q9GZS0)

Rabbit polyclonal anti-DNAI2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNAI2.

Rabbit Polyclonal anti-DNAI2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNAI2 antibody: synthetic peptide directed towards the N terminal of human DNAI2. Synthetic peptide located within the following region: TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHC

DNAI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNAI2