Rabbit anti-GABRB2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRB2 |
Rabbit anti-GABRB2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GABRB2 |
Rabbit Polyclonal Anti-GABRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB2 antibody: synthetic peptide directed towards the N terminal of human GABRB2. Synthetic peptide located within the following region: DNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTT |
Rabbit Polyclonal Anti-GABRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB2 antibody: synthetic peptide directed towards the N terminal of human GABRB2. Synthetic peptide located within the following region: HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW |
Rabbit Polyclonal Anti-GABRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB2 antibody: synthetic peptide directed towards the N terminal of human GABRB2. Synthetic peptide located within the following region: MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR |
GABRB2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN GABRB2 |
GABRB2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human GBRB2 |