Rabbit Polyclonal GRIP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal GRIP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human GRIP1. |
Rabbit Polyclonal GRIP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Rabbit polyclonal GRIP1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human GRIP1. |
Rabbit Polyclonal Anti-GRIP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIP1 antibody: synthetic peptide directed towards the C terminal of human GRIP1. Synthetic peptide located within the following region: RQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTP |
GRIP1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GRIP1 |
GRIP1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GRIP1 (NP_001171545.1). |
Modifications | Unmodified |