Antibodies

Jump to Filters
View as table Download
IL4R Rabbit Polyclonal Antibody
TA590766

USD 409.00

In Stock

Rabbit Polyclonal IL4 Receptor alpha Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
IL4R Rabbit Polyclonal Antibody
TA590768

USD 409.00

In Stock

Rabbit Polyclonal IL4 Receptor alpha Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
IL4R Rabbit Polyclonal Antibody
TA343045

USD 375.00

5 Days

Rabbit Polyclonal Anti-IL4R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL4R antibody is: synthetic peptide directed towards the C-terminal region of Human IL4R. Synthetic peptide located within the following region: GLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVD
IL4R Rabbit Polyclonal Antibody
TA377476

USD 220.00

3 Weeks

IL4R Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-232 of human IL4R (NP_000409.1).
Modifications Unmodified