Antibodies

Jump to Filters
View as table Download
MED31 Rabbit Polyclonal Antibody
TA345073

USD 475.00

5 Days

Rabbit Polyclonal Anti-MED31 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED31 antibody: synthetic peptide directed towards the N terminal of human MED31. Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN
MED31 Rabbit Polyclonal Antibody
TA378441

USD 220.00

3 Weeks

MED31 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human MED31 (NP_057144.1).
Modifications Unmodified