Antibodies

View as table Download

Rabbit Polyclonal antibody to MPP2 (membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2))

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 86 and 486 of MPP2 (Uniprot ID#Q14168)

Rabbit Polyclonal antibody to MPP2 (membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2))

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 11 and 261 of MPP2

Rabbit polyclonal Anti-MPP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MPP2 antibody: synthetic peptide directed towards the middle region of human MPP2. Synthetic peptide located within the following region: QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME

MPP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human MPP2 (NP_005365.3).
Modifications Unmodified