Germany
Japan
United Kingdom
China
Goat Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DTRPTVRPRNDVAHK, from the internal region of the protein sequence according to NP_004542.1. |
Antibodies
View as table Download
Rabbit polyclonal Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ |
Rabbit polyclonal Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK |
NDUFS3 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 37-264 of human NDUFS3 (NP_004542.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NDUFS3
Reactivities
- Human
Applications
- WB