Antibodies

View as table Download

Rabbit polyclonal anti-NLE1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NLE1.

Rabbit Polyclonal Anti-NLE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLE1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLE1. Synthetic peptide located within the following region: DSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWR

NLE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 268-353 of human NLE1 (NP_060566.2).
Modifications Unmodified