Antibodies

View as table Download

Rabbit Polyclonal Anti-ORC4L Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ORC4L antibody: synthetic peptide directed towards the middle region of human ORC4L. Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Goat Polyclonal Antibody against ORC4L

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DVRQWATSSLSWL, from the C Terminus of the protein sequence according to NP_002543.

ORC4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ORC4

ORC4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ORC4

ORC4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ORC4

ORC4L Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 187-436 of human ORC4L (NP_002543.2).
Modifications Unmodified