Antibodies

Jump to Filters
View as table Download
PPM1K Rabbit Polyclonal Antibody
TA308361

USD 415.00

5 Days

Rabbit polyclonal antibody to PPM1K (protein phosphatase 1K (PP2C domain containing))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 364 of PPM1K (Uniprot ID#Q8N3J5)
PPM1K Rabbit Polyclonal Antibody
TA338871

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPM1K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPM1K antibody: synthetic peptide directed towards the middle region of human PPM1K. Synthetic peptide located within the following region: AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA
PPM1K Rabbit Polyclonal Antibody
TA380225

USD 220.00

3 Weeks

PPM1K Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 183-372 of human PPM1K (NP_689755.3).
Modifications Unmodified