Rabbit polyclonal PRELP Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PRELP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 257-286 amino acids from the C-terminal region of human PRELP. |
Rabbit Polyclonal Anti-PRELP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRELP antibody: synthetic peptide directed towards the middle region of human PRELP. Synthetic peptide located within the following region: SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH |
Rabbit polyclonal PRELP Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PRELP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 119-148 amino acids from the Central region of human PRELP. |
PRELP rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PRELP |
Germany
Japan
United Kingdom
China
