Rabbit polyclonal PURB Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PURB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 260-289 amino acids from the C-terminal region of human PURB. |
Rabbit Polyclonal Anti-PURB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PURB antibody: synthetic peptide directed towards the N terminal of human PURB. Synthetic peptide located within the following region: MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDV |
PURB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PURB. |
Germany
Japan
United Kingdom
China
