Rabbit Polyclonal Anti-RPL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: GVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIY |
Rabbit Polyclonal Anti-RPL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPL9 antibody: synthetic peptide directed towards the C terminal of human RPL9. Synthetic peptide located within the following region: ELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE |
RPL9 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human RPL9 (NP_000652.2). |
| Modifications | Unmodified |
RPL9 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-192 of human RPL9 (NP_000652.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China