Antibodies

View as table Download

Rabbit Polyclonal Anti-C2orf18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2orf18 antibody: synthetic peptide directed towards the middle region of human C2orf18. Synthetic peptide located within the following region: GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVA

SLC35F6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C2ORF18