Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-Somatostatin Receptor Type 2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)ERSDSKQDKSRLNETTETQRT corresponding to residues 339-359 of rat Somatostatin Receptor Type 2? . Intracellular, C-terminus. |
Rabbit Polyclonal Anti-SSTR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSTR2 antibody is: synthetic peptide directed towards the C-terminal region of Human SSTR2. Synthetic peptide located within the following region: KKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
Rabbit Polyclonal Anti-SSTR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSTR2 antibody: synthetic peptide directed towards the middle region of human SSTR2. Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL |
Anti-SSTR2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2 |
Anti-SSTR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 355-369 amino acids of human somatostatin receptor 2 |
SSTR2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SSTR2 (NP_001041.1). |
| Modifications | Unmodified |
SSTR2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SSTR2 (NP_001041.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SSTR2
Reactivities
- Human
Applications
- WB