Antibodies

View as table Download

Rabbit Polyclonal Anti-ST8SIA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST8SIA4 antibody: synthetic peptide directed towards the middle region of human ST8SIA4. Synthetic peptide located within the following region: DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM

Rabbit polyclonal ST8SIA4 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ST8SIA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-214 amino acids from the Central region of human ST8SIA4.

ST8SIA4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ST8SIA4

ST8SIA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-168 of human ST8SIA4 (NP_778222.1).
Modifications Unmodified