Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ADA2L Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADA2L Antibody: A synthesized peptide derived from human ADA2L |
Antibodies
View as table Download
Rabbit polyclonal anti-ADA2L antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADA2L. |
Rabbit Polyclonal Anti-TADA2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TADA2L Antibody: synthetic peptide directed towards the C terminal of human TADA2L. Synthetic peptide located within the following region: RRQADIDSGLSPSIPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMV |
Rabbit Polyclonal Anti-TADA2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TADA2L antibody: synthetic peptide directed towards the N terminal of human TADA2L. Synthetic peptide located within the following region: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF |
Rabbit Polyclonal Anti-TADA2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TADA2L antibody: synthetic peptide directed towards the middle region of human TADA2L. Synthetic peptide located within the following region: LEYKSALLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG |
TADA2A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-443 of human TADA2A (NP_001159577.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TADA2A
Reactivities
- Human
Applications
- WB