Rabbit Polyclonal VENTX Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VENTX antibody was raised against a 16 amino acid synthetic peptide near the center of human VENTX. |
Rabbit Polyclonal VENTX Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VENTX antibody was raised against a 16 amino acid synthetic peptide near the center of human VENTX. |
Rabbit polyclonal anti-VENTX antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Xenopus |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 76 of human VENTX |
Rabbit Polyclonal Anti-VENTX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: VAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDA |
Rabbit Polyclonal Anti-VENTX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE |
VENTX Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human VENTX (NP_055283.1). |
Modifications | Unmodified |