Antibodies

Jump to Filters
View as table Download
ADRM1 Rabbit Polyclonal Antibody
TA342591

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADRM1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRM1 antibody: synthetic peptide directed towards the C terminal of human ADRM1. Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE
ADRM1 Rabbit Polyclonal Antibody
TA373327

USD 220.00

3 Weeks

ADRM1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 108-407 of human ADRM1 (NP_008933.2).
Modifications Unmodified