Rabbit Polyclonal Anti-Aste1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aste1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Aste1. Synthetic peptide located within the following region: TKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLM |
Aste1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
ASTE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASTE1 |
Germany
Japan
United Kingdom
China