Antibodies

Jump to Filters
View as table Download
Class A basic helix loop helix protein 9 (BHLHA9) Rabbit Polyclonal Antibody
TA372247

USD 380.00

4 Weeks

BHLHA9 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BHLHA9
Bhlha9 Rabbit Polyclonal Antibody
TA329615

USD 375.00

5 Days

Rabbit polyclonal anti-A830053O21Rik antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-A830053O21Rik antibody: synthetic peptide directed towards the middle region of mouse A830053O21Rik. Synthetic peptide located within the following region: RKRERPTRSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKI
BHLHA9 Rabbit Polyclonal Antibody
TA368007

USD 380.00

4 Weeks

BHLHA9 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human BHLHA9