Antibodies

Jump to Filters
View as table Download
Protein S (PROS1) Rabbit Polyclonal Antibody
TA335142

USD 375.00

5 Days

Rabbit polyclonal Anti-PROS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
Protein S (PROS1) Rabbit Polyclonal Antibody
TA380400

USD 220.00

3 Weeks

PROS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 405-676 of human PROS1 (NP_000304.2).
Modifications Unmodified