Antibodies

Jump to Filters
View as table Download
BMP10 Rabbit Polyclonal Antibody
TA372109

USD 380.00

4 Weeks

BMP10 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP10
BMP10 Rabbit Polyclonal Antibody
TA341939

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-Bmp10 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bmp10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KFATDRTSMPSANIIRSFKNEDLFSQPVSFNGIRKYPLLFNVSIPHHEEV
BMP10 Rabbit Polyclonal Antibody
TA308417

USD 415.00

5 Days

Rabbit polyclonal antibody to BMP10 (bone morphogenetic protein 10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 360 and 424 of BMP10 (Uniprot ID#O95393)
BMP10 Rabbit Polyclonal Antibody
TA374025

USD 220.00

3 Weeks

BMP10 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-316 of human BMP10 (NP_055297.1).
Modifications Unmodified