Antibodies

Jump to Filters
View as table Download
ACOT11 (C-term) Rabbit Polyclonal Antibody
AP50050PU-N

USD 450.00

2 Weeks

ACOT11 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 556-583 amino acids from the C-terminal region of human ACOT11
ACOT11 Rabbit Polyclonal Antibody
TA333492

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACOT11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACOT11 Antibody: synthetic peptide directed towards the middle region of human ACOT11. Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL
ACOT11 Rabbit Polyclonal Antibody
TA333810

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACOT11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACOT11 Antibody: synthetic peptide directed towards the middle region of human ACOT11. Synthetic peptide located within the following region: YVIALRSVTLPTHRETPEYRRGETLCSGFCLWREGDQLTKCCWVRVSLTE
ACOT11 Rabbit Polyclonal Antibody
TA322344

USD 345.00

In Stock

Anti-ACOT11 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
ACOT11 Rabbit Polyclonal Antibody
TA322345

USD 345.00

4 Weeks

Anti-ACOT11 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein