Antibodies

Jump to Filters
View as table Download
ALKBH3 Rabbit Polyclonal Antibody
TA332927

USD 345.00

3 Weeks

Rabbit anti-ALKBH3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALKBH3
ALKBH3 Rabbit Polyclonal Antibody
TA333528

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALKBH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALKBH3 Antibody: synthetic peptide directed towards the middle region of human ALKBH3. Synthetic peptide located within the following region: EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS