Rabbit Polyclonal Anti-ABP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801) |
ABP1 (AOC1) rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) goat polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) goat polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
AOC1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human AOC1 (NP_001082.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
