Antibodies

Jump to Filters
View as table Download
ATP11C Rabbit Polyclonal Antibody
TA335364

USD 375.00

5 Days

Rabbit Polyclonal Anti-Atp11c Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Atp11c Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH
ATP11C Rabbit Polyclonal Antibody
TA373799

USD 220.00

3 Weeks

ATP11C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 430-650 of human ATP11C (NP_775965.2).
Modifications Unmodified