Rabbit anti-CBFB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBFB |
Rabbit anti-CBFB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBFB |
Rabbit polyclonal CBFB Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CBFB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from the Central region of human CBFB. |
Rabbit polyclonal anti-CBF beta antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CBF β. |
CBFB rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-PPP4R1L antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP4R1L. |
Goat Polyclonal CBFB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EARRQQDPSPGSN, from the internal region (near C Terminus) of the protein sequence according to NP_074036.1; NP_001746.1 |
Rabbit Polyclonal anti-CBFB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CBFB antibody is: synthetic peptide directed towards the N-terminal region of Human CBFB. Synthetic peptide located within the following region: MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRD |
CBFB Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PEBB |
CBFB rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
CBFB rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |