Antibodies

Jump to Filters
View as table Download
CNO6L (CNOT6L) Rabbit Polyclonal Antibody
TA331316

USD 375.00

5 Days

Rabbit Polyclonal Anti-CNOT6L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CNOT6L antibody is: synthetic peptide directed towards the middle region of Human CNOT6L. Synthetic peptide located within the following region: AKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLN